Recombinant Human MYOF Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NZM1

Gene Name: MYOF

Expression System: Escherichia coli

Molecular Weight: 18.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 93%

Start Site: Gln1391

End Site: Pro1530

Coverage: 0.07

Isoelectric Point: 5

Core Sequence: QCTIERLDRFRCDPYAGKEDIVPQLKASLLSAPPCRDIVIEMEDTKPLLASKLTEKEEEIVDWWSKFYASSGEHEKCGQYIQKGYSKLKIYNCELENVAEFEGLTDFSDTFKLYRGKSDENEDPSVVGEFKGSFRIYPLP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 93%, Rat - 46%, Pig - 94%, Cynomolgus monkey - 99%

Alternative gene names: FER1L3; KIAA1207

Alternative protein names: Myoferlin; Fer-1-like protein 3

Protein name: myoferlin

Full length: 2061 amino acids

Entry name: MYOF_HUMAN

• SKU: ASBPP-2861-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2861-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 26509