Recombinant Human NOL11 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9H8H0

Gene Name: NOL11

Expression System: Escherichia coli

Molecular Weight: 20.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 74%

Start Site: Lys411

End Site: Asp570

Coverage: 0.23

Isoelectric Point: 4.5

Core Sequence: KHIEVEVRKFLALKQTPDFHTVIGDTVTGLLERCKAEPSFYPRNCLMQLIQTHVLSYSLCPDLMEIALKKKDVQLLQLCLQQFPDIPESVTCACLKIFLSIGDDSLQETDVNMESVFDYSINSVHDEKMEEQTEILQNGFNPEEDKCNNCDQELNKKPQD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 74%, Pig - 79%, Cynomolgus monkey - 96%

Alternative gene names: /

Alternative protein names: Nucleolar protein 11

Protein name: nucleolar protein 11

Full length: 719 amino acids

Entry name: NOL11_HUMAN

• SKU: ASBPP-2774-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2774-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 25926