Recombinant Human NRXN3 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9HDB5

Gene Name: NRXN3

Expression System: Escherichia coli

Molecular Weight: 16 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 54%

Start Site: Ser301

End Site: Thr430

Coverage: 0.23

Isoelectric Point: 4

Core Sequence: SIQPTSDDLVSSAECSSDDEDFVECEPSTGGELVIPLLVEDPLATPPIATRAPSITLPPTFRPLLTIIETTKDSLSMTSEAGLPCLSDQGSDGCDDDGLVISGYGSGETFDSNLPPTDDEDFYTTFSLVT

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 54%, Rat - 54%, Pig - 98%, Cynomolgus monkey - 100%

Alternative gene names: KIAA0743

Alternative protein names: Neurexin-3-beta; Neurexin III-beta) [Cleaved into: Neurexin-3-beta; soluble form; Neurexin-3-beta; C-terminal fragment; NRXN3-CTF]

Protein name: Neurexin-3-beta (Neurexin III-beta)

Full length: 637 amino acids

Entry name: NRX3B_HUMAN

• SKU: ASBPP-2798-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2798-100
• Package Unit: 100 μg
• Quantity Unit: STK