Recombinant Human OTOF Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9HC10

Gene Name: OTOF

Expression System: Escherichia coli

Molecular Weight: 17.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 90%

Start Site: Lys1331

End Site: Arg1470

Coverage: 0.07

Isoelectric Point: 5

Core Sequence: KYFASIDTMKEQLRQQEPSGIDLEEKEEVDNTEGLKGSMKGKEKARAAKEEKKKKTQSSGSGQGSEAPEKKKPKIDELKVYPKELESEFDNFEDWLHTFNLLRGKTGDDEDGSTEEERIVGRFKGSLCVYKVPLPEDVSR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 90%, Rat - 91%, Pig - 90%, Cynomolgus monkey - 99%

Alternative gene names: FER1L2

Alternative protein names: Otoferlin; Fer-1-like protein 2

Protein name: otoferlin

Full length: 1997 amino acids

Entry name: OTOF_HUMAN

• SKU: ASBPP-2787-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2787-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 9381