Recombinant Human PKDREJ Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NTG1

Gene Name: PKDREJ

Expression System: Escherichia coli

Molecular Weight: 15.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 31%

Start Site: Glu1461

End Site: Ile1570

Coverage: 0.05

Isoelectric Point: 10.5

Core Sequence: EVSPQKHPLMSEASEHWEEYLRKWHAYETAKVHPREVAKPASKGKPRLPKASPKATSKPKHRHRKAQIKTPETLGPNTNSNNNIEDDQDVHSEQHPSQKDLQQLKKKPRI

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 31%, Pig - 45%, Cynomolgus monkey - 93%

Alternative gene names: /

Alternative protein names: Polycystin family receptor for egg jelly; PKD and REJ homolog; Polycystic kidney disease and receptor for egg jelly-related protein

Protein name: polycystin family receptor for egg jelly

Full length: 2253 amino acids

Entry name: PKDRE_HUMAN

• SKU: ASBPP-2824-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2824-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 10343