Note: Dry Ice fees will be extra-charged
Uniprot: Q9UD71
Gene Name: PPP1R1B
Expression System: Escherichia coli
Molecular Weight: 13.5 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 91%
Start Site: Phe11
End Site: Gln100
Coverage: 0.53
Isoelectric Point: 10
Core Sequence: FSVPAPPSQLDPRQVEMIRRRRPTPAMLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQ
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 91%, Rat - 94%, Pig - 98%, Cynomolgus monkey - 88%
Alternative gene names: DARPP32
Alternative protein names: Protein phosphatase 1 regulatory subunit 1B; DARPP-32; Dopamine- and cAMP-regulated neuronal phosphoprotein
Protein name: protein phosphatase 1 regulatory inhibitor subunit 1B
Full length: 204 amino acids
Entry name: PPR1B_HUMAN
Product panel: Neurodegenerative Diseases Marker,Neuroscience Biomarkers
English
Deutsch
