Recombinant Human PRDM10 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NQV6

Gene Name: PRDM10

Expression System: Escherichia coli

Molecular Weight: 17 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 85%

Start Site: Trp11

End Site: Glu140

Coverage: 0.12

Isoelectric Point: 4

Core Sequence: WPTSAEHEQNAAQVHFVPDTGTVAQIVYTDDQVRPPQQVVYTADGASYTSVDGPEHTLVYIHPVEAAQTLFTDPGQVAYVQQDATAQQASLPVHNQVLPSIESVDGSDPLATLQTPLGRLEAKEEEDEDE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 85%, Pig - 93%, Cynomolgus monkey - 99%

Alternative gene names: KIAA1231; PFM7; TRIS

Alternative protein names: PR domain zinc finger protein 10; PR domain-containing protein 10; Tristanin

Protein name: PR/SET domain 10

Full length: 1147 amino acids

Entry name: PRD10_HUMAN

Product panel: DNA binding & Chromatin,Enzyme

• SKU: ASBPP-10344-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-10344-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 56980