Recombinant Human PRDM7 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NQW5

Gene Name: PRDM7

Expression System: Escherichia coli

Molecular Weight: 16 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 68%

Start Site: Lys121

End Site: Leu240

Coverage: 0.26

Isoelectric Point: 7.5

Core Sequence: KASFNNESSLRELSGTPNLLNTSDSEQAQKPVSPPGEASTSGQHSRLKLELRRKETEGKMYSLRERKGHAYKEISEPQDDDYLYCEMCQNFFIDSCAAHGPPTFVKDSAVDKGHPNRSAL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 68%, Rat - 66%, Pig - 73%, Cynomolgus monkey - 93%

Alternative gene names: PFM4

Alternative protein names: Histone-lysine N-methyltransferase PRDM7; PR domain zinc finger protein 7; PR domain-containing protein 7; [histone H3]-lysine4 N-methyltransferase PRDM7

Protein name: PR/SET domain 7

Full length: 492 amino acids

Entry name: PRDM7_HUMAN

Product panel: Enzyme

• SKU: ASBPP-2814-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2814-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 11105