Recombinant Human PRDM9 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NQV7

Gene Name: PRDM9

Expression System: Escherichia coli

Molecular Weight: 17.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 68%

Start Site: Val101

End Site: Leu240

Coverage: 0.16

Isoelectric Point: 9.5

Core Sequence: VKPPWMALRVEQRKHQKGMPKASFSNESSLKELSRTANLLNASGSEQAQKPVSPSGEASTSGQHSRLKLELRKKETERKMYSLRERKGHAYKEVSEPQDDDYLYCEMCQNFFIDSCAAHGPPTFVKDSAVDKGHPNRSAL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 68%, Rat - 63%, Pig - 74%, Cynomolgus monkey - 91%

Alternative gene names: PFM6

Alternative protein names: Histone-lysine N-methyltransferase PRDM9; PR domain zinc finger protein 9; PR domain-containing protein 9; Protein-lysine N-methyltransferase PRDM9; [histone H3]-lysine36 N-trimethyltransferase PRDM9; [histone H3]-lysine4 N-trimethyltransferase PRDM9; [histone H3]-lysine9 N-trimethyltransferase PRDM9; [histone H4]-N-methyl-L-lysine20 N-methyltransferase PRDM9; [histone H4]-lysine20 N-methyltransferase PRDM9

Protein name: PR/SET domain 9

Full length: 894 amino acids

Entry name: PRDM9_HUMAN

Product panel: Enzyme

• SKU: ASBPP-2813-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2813-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 56979