Recombinant Human PSMB10 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P40306

Gene Name: PSMB10

Expression System: Escherichia coli

Molecular Weight: 26 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 89%

Start Site: Thr40

End Site: Glu273

Coverage: 1.00

Isoelectric Point: 7

Core Sequence: TTIAGLVFQDGVILGADTRATNDSVVADKSCEKIHFIAPKIYCCGAGVAADAEMTTRMVASKMELHALSTGREPRVATVTRILRQTLFRYQGHVGASLIVGGVDLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQGLLVEAVTAGILGDLGSGGNVDACVITKTGAKLLRTLSSPTEPVKRSGRYHFVPGTTAVLTQTVKPLTLELVEETVQAMEVE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 89%, Rat - 89%, Pig - 91%, Cynomolgus monkey - 97%

Alternative gene names: LMP10; MECL1

Alternative protein names: Proteasome subunit beta type-10; Low molecular mass protein 10; Macropain subunit MECl-1; Multicatalytic endopeptidase complex subunit MECl-1; Proteasome MECl-1; Proteasome subunit beta-2i

Protein name: proteasome 20S subunit beta 10

Full length: 273 amino acids

Entry name: PSB10_HUMAN

Product panel: Enzyme

• SKU: ASBPP-285-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-285-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 5699