Recombinant Human RBAK Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NYW8

Gene Name: RBAK

Expression System: Escherichia coli

Molecular Weight: 14.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 66%

Start Site: Lys11

End Site: Leu110

Coverage: 0.16

Isoelectric Point: 4.5

Core Sequence: KDVAVDFTQEEWQQLDPDEKITYRDVMLENYSHLVSVGYDTTKPNVIIKLEQGEEPWIMGGEFPCQHSPEAWRVDDLIERIQENEDKHSRQAACINSKTL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 66%, Rat - 53%, Pig - 77%, Cynomolgus monkey - 96%

Alternative gene names: ZNF769

Alternative protein names: RB-associated KRAB zinc finger protein; RB-associated KRAB repressor; hRBaK; Zinc finger protein 769

Protein name: RB associated KRAB zinc finger

Full length: 714 amino acids

Entry name: RBAK_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-2855-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2855-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 57786