Recombinant Human RCOR3 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9P2K3

Gene Name: RCOR3

Expression System: Escherichia coli

Molecular Weight: 25.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 56%

Start Site: Lys181

End Site: Thr390

Coverage: 0.43

Isoelectric Point: 8.5

Core Sequence: KEGNTEQPVQTSKIGLGRREYQSLQHRHHSQRSKCRPPKGMYLTQEDVVAVSCSPNAANTILRQLDMELISLKRQVQNAKQVNSALKQKMEGGIEEFKPPESNQKINARWTTEEQLLAVQGVRKYGKDFQAIADVIGNKTVGQVKNFFVNYRRRFNLEEVLQEWEAEQGTQASNGDASTLGEETKSASNVPSGKSTDEEEEAQTPQAPRT

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 56%, Rat - 56%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: KIAA1343

Alternative protein names: REST corepressor 3

Protein name: REST corepressor 3

Full length: 495 amino acids

Entry name: RCOR3_HUMAN

• SKU: ASBPP-2874-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2874-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 55758