Recombinant Human RERE Protein

Recombinant Human RERE Protein
SKU
ASBPP-2877-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9P2R6

Gene Name: RERE

Expression System: Escherichia coli

Molecular Weight: 14.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 98%

Start Site: Asp531

End Site: Ala640

Coverage: 0.07

Isoelectric Point: 10.5

Core Sequence: DCRIHFKKYGELPPIEKPVDPPPFMFKPVKEEDDGLSGKHSMRTRRSRGSMSTLRSGRKKQPASPDGRTSPINEDIRSSGRNSPSAASTSSNDSKAETVKKSAKKVKEEA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 98%, Rat - 97%, Pig - 98%, Cynomolgus monkey - 47%

Alternative gene names: ARG; ARP; ATN1L; KIAA0458

Alternative protein names: Arginine-glutamic acid dipeptide repeats protein; Atrophin-1-like protein; Atrophin-1-related protein

Protein name: arginine-glutamic acid dipeptide repeats

Full length: 1566 amino acids

Entry name: RERE_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-2877-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2877-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 473
Product information (PDF)
×
MSDS (PDF)
×