Recombinant Human RESF1 Protein

Recombinant Human RESF1 Protein
SKU
ASBPP-2796-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9HCM1

Gene Name: RESF1

Expression System: Escherichia coli

Molecular Weight: 25 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 50%

Start Site: Ala1101

End Site: His1300

Coverage: 0.12

Isoelectric Point: 6

Core Sequence: ADQIQITILSSEQMKEIFPEQDDQPYVVDKLAEPQKEEPITEVVSQCDLQAPAAGQSRDSVILDSEKDDIHCCALGWLSMVYEGVPQCQCNSIKNSSSEEEKQKEQCSPLDTNSCKQGERTSDRDVTVVQFKSLVNNPKTPPDGKSHFPELQDDSRKDTPKTKHKSLPRTEQELVAGQFSSKCDKLNPLQNHKRKKLRFH

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 50%, Pig - 59%, Cynomolgus monkey - 88%

Alternative gene names: C12orf35; KIAA1551

Alternative protein names: Retroelement silencing factor 1

Protein name: retroelement silencing factor 1

Full length: 1747 amino acids

Entry name: RESF1_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-2796-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2796-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 55196
Product information (PDF)
×
MSDS (PDF)
×