Recombinant Human RNASEH2C Protein

Recombinant Human RNASEH2C Protein
SKU
ASBPP-10354-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q8TDP1

Gene Name: RNASEH2C

Expression System: Escherichia coli

Molecular Weight: 19 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 66%

Start Site: Met1

End Site: Asp164

Coverage: 1.00

Isoelectric Point: 5.5

Core Sequence: MESGDEAAIERHRVHLRSATLRDAVPATLHLLPCEVAVDGPAPVGRFFTPAIRQGPEGLEVSFRGRCLRGEEVAVPPGLVGYVMVTEEKKVSMGKPDPLRDSGTDDQEEEPLERDFDRFIGATANFSRFTLWGLETIPGPDAKVRGALTWPSLAAAIHAQVPED

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 66%, Pig - 73%, Cynomolgus monkey - 95%

Alternative gene names: AYP1

Alternative protein names: Ribonuclease H2 subunit C; RNase H2 subunit C; Aicardi-Goutieres syndrome 3 protein; AGS3; RNase H1 small subunit; Ribonuclease HI subunit C

Protein name: ribonuclease H2 subunit C

Full length: 164 amino acids

Entry name: RNH2C_HUMAN
More Information
SKU ASBPP-10354-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-10354-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 84153
Product information (PDF)
×
MSDS (PDF)
×