Recombinant Human RNF150 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9ULK6

Gene Name: RNF150

Expression System: Escherichia coli

Molecular Weight: 16 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 94%

Start Site: His301

End Site: Asp430

Coverage: 0.34

Isoelectric Point: 4

Core Sequence: HKSCVDPWLLDHRTCPMCKMNILKALGIPPNADCMDDLPTDFEGSLGGPPTNQITGASDTTVNESSVTLDPAVRTVGALQVVQDTDPIPQEGDVIFTTNSEQEPAVSSDSDISLIMAMEVGLSDVELSTD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 94%, Rat - 45%, Pig - 98%, Cynomolgus monkey - 99%

Alternative gene names: KIAA1214

Alternative protein names: RING finger protein 150

Protein name: ring finger protein 150

Full length: 438 amino acids

Entry name: RN150_HUMAN

Product panel: E3 Ligase

• SKU: ASBPP-2924-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2924-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 57484