Recombinant Human RNF19A Protein

Recombinant Human RNF19A Protein
SKU
ASBPP-2831-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9NV58

Gene Name: RNF19A

Expression System: Escherichia coli

Molecular Weight: 16.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 81%

Start Site: Glu691

End Site: Leu810

Coverage: 0.16

Isoelectric Point: 4.5

Core Sequence: EDMDAQLLEQQSTNSSEFEAPSLSDSMPSVADSHSSHFSEFSCSDLESMKTSCSHGSSDYHTRFATVNILPEVENDRLENSPHQCSISVVTQTASCSEVSQLNHIAEEHGNNGIKPNVDL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 81%, Pig - 93%, Cynomolgus monkey - 96%

Alternative gene names: RNF19

Alternative protein names: E3 ubiquitin-protein ligase RNF19A; Double ring-finger protein; Dorfin; RING finger protein 19A; p38

Protein name: ring finger protein 19A, RBR E3 ubiquitin protein ligase

Full length: 838 amino acids

Entry name: RN19A_HUMAN

Product panel: E3 Ligase,Enzyme
More Information
SKU ASBPP-2831-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2831-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 25897
Product information (PDF)
×
MSDS (PDF)
×