Recombinant Human SEH1L Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q96EE3

Gene Name: SEH1L

Expression System: Escherichia coli

Molecular Weight: 20.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 94%

Start Site: Pro191

End Site: Leu350

Coverage: 0.49

Isoelectric Point: 9

Core Sequence: PNAMAKVQIFEYNENTRKYAKAETLMTVTDPVHDIAFAPNLGRSFHILAIATKDVRIFTLKPVRKELTSSGGPTKFEIHIVAQFDNHNSQVWRVSWNITGTVLASSGDDGCVRLWKANYMDNWKCTGILKGNGSPVNGSSQQGTSNPSLGSTIPSLQNSL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 94%, Rat - 32%, Pig - 94%, Cynomolgus monkey - 99%

Alternative gene names: SEC13L; SEH1

Alternative protein names: Nucleoporin SEH1; GATOR2 complex protein SEH1; Nup107-160 subcomplex subunit SEH1; SEC13-like protein

Protein name: SEH1 like nucleoporin

Full length: 360 amino acids

Entry name: SEH1_HUMAN

• SKU: ASBPP-10343-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-10343-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 81929