Recombinant Human SLC12A6 Protein

Recombinant Human SLC12A6 Protein
SKU
ASBPP-2895-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9UHW9

Gene Name: SLC12A6

Expression System: Escherichia coli

Molecular Weight: 20.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 96%

Start Site: Ala11

End Site: Glu170

Coverage: 0.15

Isoelectric Point: 5

Core Sequence: ASVRFMVTPTKIDDIPGLSDTSPDLSSRSSSRVRFSSRESVPETSRSEPMSEMSGATTSLATVALDPPSDRTSHPQDVIEDLSQNSITGEHSQLLDDGHKKARNAYLNNSNYEEGDEYFDKNLALFEEEMDTRPKVSSLLNRMANYTNLTQGAKEHEEAE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 96%, Rat - 61%, Pig - 95%, Cynomolgus monkey - 98%

Alternative gene names: KCC3

Alternative protein names: Solute carrier family 12 member 6; Electroneutral potassium-chloride cotransporter 3; K-Cl cotransporter 3

Protein name: solute carrier family 12 member 6

Full length: 1150 amino acids

Entry name: S12A6_HUMAN
More Information
SKU ASBPP-2895-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2895-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 9990
Product information (PDF)
×
MSDS (PDF)
×