Recombinant Human SLC24A2 Protein

Recombinant Human SLC24A2 Protein
SKU
ASBPP-2897-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9UI40

Gene Name: SLC24A2

Expression System: Escherichia coli

Molecular Weight: 20.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 87%

Start Site: Pro311

End Site: Gln470

Coverage: 0.26

Isoelectric Point: 6

Core Sequence: PSAARDKDEPTLPAKPRLQRGGSSASLHNSLMRNSIFQLMIHTLDPLAEELGSYGKLKYYDTMTEEGRFREKASILHKIAKKKCHVDENERQNGAANHVEKIELPNSTSTDVEMTPSSDASEPVQNGNLSHNIEGAEAQTADEEEDQPLSLAWPSETRKQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 87%, Rat - 85%, Pig - 91%, Cynomolgus monkey - 98%

Alternative gene names: NCKX2

Alternative protein names: Sodium/potassium/calcium exchanger 2; Na(+)/K(+)/Ca(2+)-exchange protein 2; Retinal cone Na-Ca+K exchanger; Solute carrier family 24 member 2

Protein name: solute carrier family 24 member 2

Full length: 661 amino acids

Entry name: NCKX2_HUMAN
More Information
SKU ASBPP-2897-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2897-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 25769
Product information (PDF)
×
MSDS (PDF)
×