Recombinant Human SLC39A10 Protein

Recombinant Human SLC39A10 Protein
SKU
ASBPP-2918-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9ULF5

Gene Name: SLC39A10

Expression System: Escherichia coli

Molecular Weight: 15 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 88%

Start Site: Tyr521

End Site: Gly630

Coverage: 0.15

Isoelectric Point: 6.5

Core Sequence: YKQQRGKQKWFMKQNTEESTIGRKLSDHKLNNTPDSDWLQLKPLAGTDDSVVSEDRLNETELTDLEGQQESPPKNYLCIEEEKIIDHSHSDGLHTIHEHDLHAAAHNHHG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 88%, Pig - 95%, Cynomolgus monkey - 99%

Alternative gene names: KIAA1265; ZIP10

Alternative protein names: Zinc transporter ZIP10; Solute carrier family 39 member 10; Zrt- and Irt-like protein 10; ZIP-10

Protein name: solute carrier family 39 member 10

Full length: 831 amino acids

Entry name: S39AA_HUMAN
More Information
SKU ASBPP-2918-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2918-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 57181
Product information (PDF)
×
MSDS (PDF)
×