Recombinant Human SYNDIG1 Protein

Recombinant Human SYNDIG1 Protein
SKU
ASBPP-2772-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9H7V2

Gene Name: SYNDIG1

Expression System: Escherichia coli

Molecular Weight: 21.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 91%

Start Site: Leu11

End Site: Asp180

Coverage: 0.70

Isoelectric Point: 4.5

Core Sequence: LVHSKISDAGKRNGLINTRNLMAESRDGLVSVYPAPQYQSHRVGASTVPASLDSSRSEPMQQLLDPNTLQQSVESRYRPNIILYSEGVLRSWGDGVAADCCETTFIEDRSPTKDSLEYPDGKFIDLSADDIKIHTLSYDVEEEEEFQELESDYSSDTESEDNFLMMPPRD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 91%, Rat - 89%, Pig - 87%, Cynomolgus monkey - 98%

Alternative gene names: C20orf39; TMEM90B

Alternative protein names: Synapse differentiation-inducing gene protein 1; SynDIG1; Dispanin subfamily C member 2; DSPC2; Transmembrane protein 90B

Protein name: synapse differentiation inducing 1

Full length: 258 amino acids

Entry name: SYNG1_HUMAN
More Information
SKU ASBPP-2772-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2772-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 79953
Product information (PDF)
×
MSDS (PDF)
×