Recombinant Human TFCP2L1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NZI6

Gene Name: TFCP2L1

Expression System: Escherichia coli

Molecular Weight: 15.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 91%

Start Site: Val191

End Site: Ser310

Coverage: 0.26

Isoelectric Point: 6

Core Sequence: VQIDTFKQNENGEYTEHLHSASCQIKVFKPKGADRKQKTDREKMEKRTAQEKEKYQPSYETTILTECSPWPDVAYQVNSAPSPSYNGSPNSFGLGEGNASPTHPVEALPVGSDHLLPSAS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 91%, Pig - 95%, Cynomolgus monkey - 99%

Alternative gene names: CRTR1; LBP9

Alternative protein names: Transcription factor CP2-like protein 1; CP2-related transcriptional repressor 1; CRTR-1; Transcription factor LBP-9

Protein name: transcription factor CP2 like 1

Full length: 479 amino acids

Entry name: TF2L1_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-2859-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2859-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 29842