Recombinant Human THEG Protein

Recombinant Human THEG Protein
SKU
ASBPP-2878-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9P2T0

Gene Name: SPMAP2

Expression System: Escherichia coli

Molecular Weight: 16 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 52%

Start Site: Gly31

End Site: Lys150

Coverage: 0.33

Isoelectric Point: 5

Core Sequence: GLQSSVYESRRVTDPERQDLDNAELGPEDPEEELPPEEVAGEEFPETLDPKEALSELERVLDKDLEEDIPEISRLSISQKLPSTTMTKARKRRRRRRLMELAEPKINWQVLKDRKGRCGK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 52%, Rat - 43%, Pig - 64%, Cynomolgus monkey - 90%

Alternative gene names: THEG

Alternative protein names: Sperm microtubule associated protein 2; Cancer/testis antigen 56; CT56; Testicular haploid expressed gene protein

Protein name: sperm microtubule associated protein 2

Full length: 379 amino acids

Entry name: SPMA2_HUMAN
More Information
SKU ASBPP-2878-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2878-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 51298
Product information (PDF)
×
MSDS (PDF)
×