Recombinant Human TMPO Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P42166

Gene Name: TMPO

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 72%

Start Site: Arg411

End Site: Ser480

Coverage: 0.12

Isoelectric Point: 6.5

Core Sequence: RIDQSKFQETEFLSPPRKVPRLSEKSVEERDSGSFVAFQNIPGSELMSSFAKTVVSHSLTTLGLEVAKQS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 72%, Pig - 79%, Cynomolgus monkey - 95%

Alternative gene names: LAP2

Alternative protein names: Lamina-associated polypeptide 2; isoform alpha; Thymopoietin isoform alpha; TP alpha; Thymopoietin-related peptide isoform alpha; TPRP isoform alpha) [Cleaved into: Thymopoietin; TP; Splenin; Thymopentin; TP5]

Protein name: Lamina-associated polypeptide 2, isoform alpha (Thymopoietin isoform alpha) (TP alpha) (Thymopoietin-related peptide isoform alpha) (TPRP isoform alpha)

Full length: 694 amino acids

Entry name: LAP2A_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-289-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-289-20
• Package Unit: 20 μg
• Quantity Unit: STK