Recombinant Human UBP1 Protein

Recombinant Human UBP1 Protein
SKU
ASBPP-2860-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9NZI7

Gene Name: UBP1

Expression System: Escherichia coli

Molecular Weight: 23.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 97%

Start Site: Glu171

End Site: Ser360

Coverage: 0.37

Isoelectric Point: 7

Core Sequence: EFLWDPAKRTSAFIQVHCISTEFTPRKHGGEKGVPFRIQVDTFKQNENGEYTDHLHSASCQIKVFKPKGADRKQKTDREKMEKRTAHEKEKYQPSYDTTILTEMRLEPIIEDAVEHEQKKSSKRTLPADYGDSLAKRGSCSPWPDAPTAYVNNSPSPAPTFTSPQQSTCSVPDSNSSSPNHQGDGASQTS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 97%, Pig - 95%, Cynomolgus monkey - 100%

Alternative gene names: LBP1

Alternative protein names: Upstream-binding protein 1; Transcription factor LBP-1

Protein name: upstream binding protein 1

Full length: 540 amino acids

Entry name: UBIP1_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-2860-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2860-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 7342
Product information (PDF)
×
MSDS (PDF)
×