Recombinant Human WDR1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O75083

Gene Name: WDR1

Expression System: Escherichia coli

Molecular Weight: 52.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-MBP & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 92%

Start Site: Lys311

End Site: Ile380

Coverage: 0.14

Isoelectric Point: 6

Core Sequence: KPLHVIKGHSKSIQCLTVHKNGGKSYIYSGSHDGHINYWDSETGENDSFAGKGHTNQVSRMTVDESGQLI

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 92%, Rat - 95%, Pig - 97%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: WD repeat-containing protein 1; Actin-interacting protein 1; AIP1; NORI-1

Protein name: WD repeat domain 1

Full length: 606 amino acids

Entry name: WDR1_HUMAN

• SKU: ASBPP-029-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-029-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 9948