Recombinant Human ZBTB26 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9HCK0

Gene Name: ZBTB26

Expression System: Escherichia coli

Molecular Weight: 20 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 28%

Start Site: Gln121

End Site: Arg280

Coverage: 0.38

Isoelectric Point: 6.5

Core Sequence: QALWKFIKPKQPMDSKEGCEPQSASPQSKEQQGDARGSPKQDSPCIHPSEDSMDMEDSDIQIVKVESIGDVSEVRSKKDQNQFISSEPTALHSSEPQHSLINSTVENRVSEIEQNHLHNYALSYTGSDNIIMASKDVFGPNIRGVDKGLQWHHQCPKCTR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 28%, Pig - 98%, Cynomolgus monkey - 100%

Alternative gene names: KIAA1572; ZNF481

Alternative protein names: Zinc finger and BTB domain-containing protein 26; Zinc finger protein 481; Zinc finger protein Bioref

Protein name: zinc finger and BTB domain containing 26

Full length: 441 amino acids

Entry name: ZBT26_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-2794-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2794-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 57684