Recombinant Human ZBTB40 Protein

Recombinant Human ZBTB40 Protein
SKU
ASBPP-2830-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9NUA8

Gene Name: ZBTB40

Expression System: Escherichia coli

Molecular Weight: 22 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 36%

Start Site: Asn691

End Site: Gly860

Coverage: 0.14

Isoelectric Point: 8.5

Core Sequence: NNKEDEKAAKEDSQPGEQNDQGETGSLPGQQEKEASASPDPAKKSFICKACDKSFHFYCRLKVHMKRCRVAKSKQVQCKECSETKDSKKELDKHQLEAHGAGGEPDAPKKKKKRLPVTCDLCGREFAHASGMQYHKLTEHFDEKPFSCEECGAKFAANSTLKNHLRLHTG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 36%, Rat - 33%, Pig - 88%, Cynomolgus monkey - 98%

Alternative gene names: KIAA0478

Alternative protein names: Zinc finger and BTB domain-containing protein 40

Protein name: zinc finger and BTB domain containing 40

Full length: 1239 amino acids

Entry name: ZBT40_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-2830-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2830-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 9923
Product information (PDF)
×
MSDS (PDF)
×