Recombinant Human ZCCHC17 Protein

Recombinant Human ZCCHC17 Protein
SKU
ASBPP-2801-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9NP64

Gene Name: ZCCHC17

Expression System: Escherichia coli

Molecular Weight: 16.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 91%

Start Site: Arg111

End Site: Lys230

Coverage: 0.53

Isoelectric Point: 10.5

Core Sequence: RRRSFQDYTGQKITLEAVLNTTCKKCGCKGHFAKDCFMQPGGTKYSLIPDEEEEKEEAKSAEFEKPDPTRNPSRKRKKEKKKKKHRDRKSSDSDSSDSESDTGKRARHTSKDSKAAKKKK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 91%, Pig - 96%, Cynomolgus monkey - 99%

Alternative gene names: PS1D

Alternative protein names: Zinc finger CCHC domain-containing protein 17; Nucleolar protein of 40 kDa; pNO40; Pnn-interacting nucleolar protein; Putative S1 RNA-binding domain protein; PS1D protein

Protein name: zinc finger CCHC-type containing 17

Full length: 241 amino acids

Entry name: ZCC17_HUMAN
More Information
SKU ASBPP-2801-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2801-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 51538
Product information (PDF)
×
MSDS (PDF)
×