Recombinant Human ZDHHC8 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9ULC8

Gene Name: ZDHHC8

Expression System: Escherichia coli

Molecular Weight: 15 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 93%

Start Site: Ser551

End Site: Pro680

Coverage: 0.17

Isoelectric Point: 10

Core Sequence: SIQERKDREERERLLRSQADSLFGDSGVYDAPSSYSLQQASVLSEGPRGPALRYGSRDDLVAGPGFGGARNPALQTSLSSLSSSVSRAPRTSSSSLQADQASSNAPGPRPSSGSHRSPARQGLPSPPGTP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 93%, Pig - 90%

Alternative gene names: KIAA1292; ZDHHCL1; ZNF378

Alternative protein names: Palmitoyltransferase ZDHHC8; Zinc finger DHHC domain-containing protein 8; DHHC-8; Zinc finger protein 378

Protein name: zinc finger DHHC-type palmitoyltransferase 8

Full length: 765 amino acids

Entry name: ZDHC8_HUMAN

Product panel: Enzyme

• SKU: ASBPP-2914-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2914-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 29801