Recombinant Human ZKSCAN7 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9P0L1

Gene Name: ZKSCAN7

Expression System: Escherichia coli

Molecular Weight: 18 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 38%

Start Site: Gly211

End Site: Thr350

Coverage: 0.20

Isoelectric Point: 5

Core Sequence: GNSGDQAGATVLRMVRPQDTVAYEDLSVDYTQKKWKSLTLSQRALQWNMMPENHHSMASLAGENMMKGSELTPKQEFFKGSESSNRTSGGLFGVVPGAAETGDVCEDTFKELEGQTSDEEGSRLENDFLEITDEDKKKST

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 38%, Rat - 47%, Pig - 61%, Cynomolgus monkey - 85%

Alternative gene names: ZNF167; ZNF448; ZNF64

Alternative protein names: Zinc finger protein with KRAB and SCAN domains 7; Zinc finger protein 167; Zinc finger protein 448; Zinc finger protein 64

Protein name: zinc finger with KRAB and SCAN domains 7

Full length: 754 amino acids

Entry name: ZKSC7_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-2864-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2864-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 55888