Recombinant Human ZMYM5 Protein

Recombinant Human ZMYM5 Protein
SKU
ASBPP-2900-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9UJ78

Gene Name: ZMYM5

Expression System: Escherichia coli

Molecular Weight: 17.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 56%

Start Site: Thr421

End Site: Phe550

Coverage: 0.21

Isoelectric Point: 6.5

Core Sequence: TKSKKLTASENRKRNAFREENEKQLYGSSNTLLKKIEGIPEKKEKTSQLQLSVECGTDTLLIQENVNLPPSSTSTIADTFQEQLEEKNFEDSIVPVVLSADPGTWPRILNIKQRDTLVENVPPQVRNFNF

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 56%, Pig - 71%, Cynomolgus monkey - 92%

Alternative gene names: ZNF198L1; ZNF237

Alternative protein names: Zinc finger MYM-type protein 5; Zinc finger protein 198-like 1; Zinc finger protein 237

Protein name: zinc finger MYM-type containing 5

Full length: 669 amino acids

Entry name: ZMYM5_HUMAN
More Information
SKU ASBPP-2900-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2900-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 9205
Product information (PDF)
×
MSDS (PDF)
×