Recombinant Human ZNF212 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9UDV6

Gene Name: ZNF212

Expression System: Escherichia coli

Molecular Weight: 18 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 77%

Start Site: Lys81

End Site: Leu220

Coverage: 0.29

Isoelectric Point: 4.5

Core Sequence: KMAVEFGNQLEGKWAVLGTLLQEYGLLQRRLENVENLLRNRNFWILRLPPGSKGEAPKVSRSLENDGVCFTEQEWENLEDWQKELYRNVMESNYETLVSLKVLGQTEGEAELGTEMLGDLEEEGPGGAHPAGGVMIKQEL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 77%, Rat - 40%, Pig - 85%, Cynomolgus monkey - 100%

Alternative gene names: ZNFC150

Alternative protein names: Zinc finger protein 212; Zinc finger protein C2H2-150

Protein name: zinc finger protein 212

Full length: 495 amino acids

Entry name: ZN212_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-2885-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2885-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 7988