Recombinant Human ZNF229 Protein

Recombinant Human ZNF229 Protein
SKU
ASBPP-2903-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9UJW7

Gene Name: ZNF229

Expression System: Escherichia coli

Molecular Weight: 17 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 69%

Start Site: Arg11

End Site: Asp130

Coverage: 0.16

Isoelectric Point: 4.5

Core Sequence: RALHSQASAISQDREEKIMSQEPLSFKDVAVVFTEEELELLDSTQRQLYQDVMQENFRNLLSVGERNPLGDKNGKDTEYIQDEELRFFSHKELSSCKIWEEVAGELPGSQDCRVNLQGKD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 69%, Rat - 50%, Pig - 55%, Cynomolgus monkey - 89%

Alternative gene names: /

Alternative protein names: Zinc finger protein 229

Protein name: zinc finger protein 229

Full length: 825 amino acids

Entry name: ZN229_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-2903-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2903-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 7772
Product information (PDF)
×
MSDS (PDF)
×