Recombinant Human ZNF277 Protein

Recombinant Human ZNF277 Protein
SKU
ASBPP-2818-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9NRM2

Gene Name: ZNF277

Expression System: Escherichia coli

Molecular Weight: 12 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 91%

Start Site: Lys231

End Site: Gln310

Coverage: 0.19

Isoelectric Point: 6

Core Sequence: KTFRDKNTLKDHMRKKQHRKINPKNREYDRFYVINYLELGKSWEEVQLEDDRELLDHQEDDWSDWEEHPASAVCLFCEKQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 91%, Pig - 97%, Cynomolgus monkey - 100%

Alternative gene names: NRIF4; ZNF277P

Alternative protein names: Zinc finger protein 277; Nuclear receptor-interacting factor 4

Protein name: zinc finger protein 277

Full length: 450 amino acids

Entry name: ZN277_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-2818-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2818-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 11179
Product information (PDF)
×
MSDS (PDF)
×