Recombinant Human ZNF277 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NRM2

Gene Name: ZNF277

Expression System: Escherichia coli

Molecular Weight: 12 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 91%

Start Site: Lys231

End Site: Gln310

Coverage: 0.19

Isoelectric Point: 6

Core Sequence: KTFRDKNTLKDHMRKKQHRKINPKNREYDRFYVINYLELGKSWEEVQLEDDRELLDHQEDDWSDWEEHPASAVCLFCEKQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 91%, Pig - 97%, Cynomolgus monkey - 100%

Alternative gene names: NRIF4; ZNF277P

Alternative protein names: Zinc finger protein 277; Nuclear receptor-interacting factor 4

Protein name: zinc finger protein 277

Full length: 450 amino acids

Entry name: ZN277_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-2818-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2818-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 11179