Recombinant Human ZNF286A Protein

Recombinant Human ZNF286A Protein
SKU
ASBPP-2786-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9HBT8

Gene Name: ZNF286A

Expression System: Escherichia coli

Molecular Weight: 26 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 53%

Start Site: Lys11

End Site: Val210

Coverage: 0.41

Isoelectric Point: 5

Core Sequence: KGALSSQDSPHFQEKSTEEGEVAALRLTARSQETVTFKDVAMDFTPEEWGKLDPAQRDVMLENYRNLVSLWLPVSKPESYNLENGKEPLKLERKAPKSSYSDMETRPQSKDSTSVQDFSKAESCKVAIIDRLTRNSVYDSNLEAALECENWLENQQGNQERHLREMFTHMNSLSEETDHKHDVYWKSFNQKSVLITEDRV

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 53%, Rat - 53%, Pig - 78%, Cynomolgus monkey - 96%

Alternative gene names: KIAA1874; ZNF286

Alternative protein names: Zinc finger protein 286A

Protein name: zinc finger protein 286A

Full length: 521 amino acids

Entry name: Z286A_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-2786-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2786-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 57335
Product information (PDF)
×
MSDS (PDF)
×