Recombinant Human ZNF287 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9HBT7

Gene Name: ZNF287

Expression System: Escherichia coli

Molecular Weight: 18 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 73%

Start Site: Leu131

End Site: Glu260

Coverage: 0.19

Isoelectric Point: 4.5

Core Sequence: LEEEAPQNSTLSQDTPEEDPRGKHAFQTGWLNDLVTKESMTFKDVAVDITQEDWELMRPVQKELYKTVTLQNYWNMVSLGLTVYRPTVIPILEEPWMVIKEILEGPSPEWETKAQACTPVEDMSKLTKEE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 73%, Rat - 48%, Pig - 83%, Cynomolgus monkey - 96%

Alternative gene names: ZKSCAN13

Alternative protein names: Zinc finger protein 287; Zinc finger protein with KRAB and SCAN domains 13

Protein name: zinc finger protein 287

Full length: 761 amino acids

Entry name: ZN287_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-2785-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2785-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 57336