Recombinant Human ZNF302 Protein

Recombinant Human ZNF302 Protein
SKU
ASBPP-2815-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9NR11

Gene Name: ZNF302

Expression System: Escherichia coli

Molecular Weight: 16 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 38%

Start Site: Ile161

End Site: Tyr280

Coverage: 0.27

Isoelectric Point: 9.5

Core Sequence: IINKEGYLYEDSPQPVTMEKVVKQSYEFSNSNKNLEYTECDTFRSTFHSKSTLSEPQNNSAEGNSHKYDILKKNLSKKSVIKSERINGGKKLLNSNKSGAAFNQSKSLTLPQTCNREKIY

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 38%, Rat - 49%, Pig - 55%, Cynomolgus monkey - 89%

Alternative gene names: ZNF135L; ZNF140L; ZNF327

Alternative protein names: Zinc finger protein 302; Zinc finger protein 135-like; Zinc finger protein 140-like; Zinc finger protein 327

Protein name: zinc finger protein 302

Full length: 478 amino acids

Entry name: ZN302_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-2815-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2815-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 55900
Product information (PDF)
×
MSDS (PDF)
×