Recombinant Human ZNF385D Protein

Recombinant Human ZNF385D Protein
SKU
ASBPP-2768-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9H6B1

Gene Name: ZNF385D

Expression System: Escherichia coli

Molecular Weight: 20 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 65%

Start Site: Val161

End Site: Pro330

Coverage: 0.43

Isoelectric Point: 10.5

Core Sequence: VEIRKSSVMTTEITSKVEKSPTTATGNSSCPSTETEEEKAKRLLYCSLCKVAVNSASQLEAHNSGTKHKTMLEARNGSGTIKAFPRAGVKGKGPVNKGNTGLQNKTFHCEICDVHVNSETQLKQHISSRRHKDRAAGKPPKPKYSPYNKLQKTAHPLGVKLVFSKEPSKP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 65%, Rat - 88%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: ZNF659

Alternative protein names: Zinc finger protein 385D; Zinc finger protein 659

Protein name: zinc finger protein 385D

Full length: 395 amino acids

Entry name: Z385D_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-2768-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2768-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 79750
Product information (PDF)
×
MSDS (PDF)
×