Recombinant Human ZNF391 Protein

Recombinant Human ZNF391 Protein
SKU
ASBPP-2902-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9UJN7

Gene Name: ZNF391

Expression System: Escherichia coli

Molecular Weight: 18.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 64%

Start Site: Pro31

End Site: Leu180

Coverage: 0.43

Isoelectric Point: 9

Core Sequence: PAQKKSSFENTVVRKVSVTLKEIFTGEEGPESSEFSLSPNLDAQQKIPKGHGSPISRKNSKDNSDLIKHQRLFSQRKPCKCNECEKAFSYQSDLLVHSRIHGGEKPFECNKCGKSFSRSTHLIEHQRTHTGEKPYECNECGKAFSRSTHL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 64%, Rat - 64%, Pig - 79%, Cynomolgus monkey - 95%

Alternative gene names: /

Alternative protein names: Zinc finger protein 391

Protein name: zinc finger protein 391

Full length: 358 amino acids

Entry name: ZN391_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-2902-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2902-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 346157
Product information (PDF)
×
MSDS (PDF)
×