Recombinant Human ZNF532 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9HCE3

Gene Name: ZNF532

Expression System: Escherichia coli

Molecular Weight: 24 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 72%

Start Site: Thr961

End Site: Leu1150

Coverage: 0.15

Isoelectric Point: 10

Core Sequence: TLKSIEGPPNLGINLPLSIKPATQNSANQNKEDTKSMNGKEKLEKKSPSPVKKSMETKKVASPGWTCWECDCLFMQRDVYISHVRKEHGKQMKKHPCRQCDKSFSSSHSLCRHNRIKHKGIRKVYACSHCPDSRRTFTKRLMLEKHVQLMHGIKDPDLKEMTDATNEEETEIKEDTKVPSPKRKLEEPVL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 72%, Rat - 41%, Pig - 94%, Cynomolgus monkey - 99%

Alternative gene names: KIAA1629

Alternative protein names: Zinc finger protein 532

Protein name: zinc finger protein 532

Full length: 1301 amino acids

Entry name: ZN532_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-2791-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2791-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 55205