Recombinant Human ZNF581 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9P0T4

Gene Name: ZNF581

Expression System: Escherichia coli

Molecular Weight: 9.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Start Site: Pro11

End Site: Ala80

Coverage: 0.41

Isoelectric Point: 7

Core Sequence: PLAFSSVETMEGPPRRTCRSPEPGPSSSIGSPQASSPPRPNHYLLIDTQGVPYTVLVDEESQREPGASGA

Homologies: Highest protein sequence identity to the following orthologs: Pig - 66%, Cynomolgus monkey - 98%

Alternative gene names: /

Alternative protein names: Zinc finger protein 581

Protein name: zinc finger protein 581

Full length: 197 amino acids

Entry name: ZN581_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-2866-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2866-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 51545