Recombinant Human ZNF624 Protein

Recombinant Human ZNF624 Protein
SKU
ASBPP-2873-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9P2J8

Gene Name: ZNF624

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 69%

Start Site: Thr651

End Site: Gly720

Coverage: 0.09

Isoelectric Point: 9.5

Core Sequence: TKSYLIVHQRTHTGEKPYKCNECEKAFTNTSQLTVHQRRHTGEKPYKCNECGKVFTSNSGFNTHQRTHTG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 69%, Rat - 65%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: KIAA1349

Alternative protein names: Zinc finger protein 624

Protein name: zinc finger protein 624

Full length: 865 amino acids

Entry name: ZN624_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-2873-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2873-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 57547
Product information (PDF)
×
MSDS (PDF)
×