Recombinant Human ZNF639 Protein

Recombinant Human ZNF639 Protein
SKU
ASBPP-2898-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9UID6

Gene Name: ZNF639

Expression System: Escherichia coli

Molecular Weight: 26.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 92%

Start Site: Lys51

End Site: Tyr260

Coverage: 0.45

Isoelectric Point: 4.5

Core Sequence: KYFDNKDDDSDTETSNDLPKFADGIKARNRNQNYLVPSPVLRILDHTAFSTEKSADIVICDEECDSPESVNQQTQEESPIEVHTAEDVPIAVEVHAISEDYDIETENNSSESLQDQTDEEPPAKLCKILDKSQALNVTAQQKWPLLRANSSGLYKCELCEFNSKYFSDLKQHMILKHKRTDSNVCRVCKESFSTNMLLIEHAKLHEEDPY

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 92%, Rat - 90%, Pig - 98%, Cynomolgus monkey - 100%

Alternative gene names: ZASC1

Alternative protein names: Zinc finger protein 639; Zinc finger protein ANC_2H01; Zinc finger protein ZASC1

Protein name: zinc finger protein 639

Full length: 485 amino acids

Entry name: ZN639_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-2898-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2898-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 51193
Product information (PDF)
×
MSDS (PDF)
×