Recombinant Human ZNF69 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9UC07

Gene Name: ZNF69

Expression System: Escherichia coli

Molecular Weight: 16 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 56%

Start Site: Met21

End Site: Val130

Coverage: 0.22

Isoelectric Point: 5

Core Sequence: MDPVAFDDVAVNFTQEEWALLDISQRKLYKEVMLETFRNLTSVGKSWKDQNIEYEYQNPRRNFRSLIEKKVNEIKDDSHCGETFTQVPDDRLNFQEKKASPEIKSCDSFV

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 56%, Rat - 54%, Pig - 51%, Cynomolgus monkey - 86%

Alternative gene names: /

Alternative protein names: Zinc finger protein 69; hZNF3

Protein name: zinc finger protein 69

Full length: 566 amino acids

Entry name: ZNF69_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-2883-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2883-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 7620