Recombinant Human ZNF69 Protein

Recombinant Human ZNF69 Protein
SKU
ASBPP-2883-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9UC07

Gene Name: ZNF69

Expression System: Escherichia coli

Molecular Weight: 16 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 56%

Start Site: Met21

End Site: Val130

Coverage: 0.22

Isoelectric Point: 5

Core Sequence: MDPVAFDDVAVNFTQEEWALLDISQRKLYKEVMLETFRNLTSVGKSWKDQNIEYEYQNPRRNFRSLIEKKVNEIKDDSHCGETFTQVPDDRLNFQEKKASPEIKSCDSFV

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 56%, Rat - 54%, Pig - 51%, Cynomolgus monkey - 86%

Alternative gene names: /

Alternative protein names: Zinc finger protein 69; hZNF3

Protein name: zinc finger protein 69

Full length: 566 amino acids

Entry name: ZNF69_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-2883-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2883-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 7620
Product information (PDF)
×
MSDS (PDF)
×