Recombinant Swine FGF-2 protein(N-His)(active)

Abbreviation: FGF-2

Target Synonym: Fgfb;bFGF;FGF-basic

Target Species: Porcine

Expression Host: E.coli

Fusion Tag: N-His

UNIProt ID: P03969

Background: Fibroblast growth factor 2(FGF2) is a secreted protein and belongs to the heparin-binding growth factors family. FGF2 is produced by epithelial; tumor and other cell types. It involved in developmental processes and regulates differentiation; proliferation; and migration; FGF2 is a critical factor for growing embryonic stem cells in culture without inducing differentiation. FGF2 has a high affinity for heparan sulfate and binding is a step in the FGF basic activation of FGFR tyrosine kinase.

Activity: Measure by its ability to induce proliferation in 3T3 cells. The ED50 for this effect is < 2 ng/mL.

Sequence: MAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS

Purity: > 98 % as determined by reducing SDS-PAGE.

Formulation: Lyophilized from a solution containing 0.01% sarkosyl in 1X PBS, pH 7.4.
Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Please refer to the specific buffer information in the printed manual.

Endotoxin: Please contact us for more information.

• SKU: ELSPKSS000016-5
• Manufacturer: Elabscience Biotechnology
• Manufacturer SKU: ELA-PKSS000016-5
• Package Unit: 5 µg
• Quantity Unit: STK
• Application: Cell Culture