RORC Antibody - N-terminal region : FITC

RORC Antibody - N-terminal region : FITC
SKU
AVIARP58193_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: RORC encodes a protein which is a DNA-binding transcription factor and is a member of the NR1 subfamily of nuclear hormone receptors. The specific functions of this protein are not known; however, studies of a similar gene in mice have shown that RORC may be essential for lymphoid organogenesis and may play an important regulatory role in thymopoiesis. In addition, studies in mice suggest that the protein encoded by this gene may inhibit the expression of Fas ligand and IL2.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human RORC

Molecular Weight: 58kDa

Peptide Sequence: Synthetic peptide located within the following region: MDRAPQRQHRASRELLAAKKTHTSQIEVIPCKICGDKSSGIHYGVITCEG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: RAR-related orphan receptor C EMBL AAI10572.1

Protein Size: 518

Purification: Affinity Purified
More Information
SKU AVIARP58193_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58193_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 6097
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×